missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein

Produktkod. 30209820
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30209820

missing translation for 'mfr': Invitrogen™ RP104388

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
TRUSTED_SUSTAINABILITY

Spezifikation

Tillträdesnummer P0DUB6
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 276
Namn Human alpha Amylase 1 (aa 242-300) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1 A (salivary); amylase, salivary, alpha-1 A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1 A; salivary and hepatic alpha-amylase
Vanligt namn alpha Amylase 1
Gensymbol AMY1A
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt