missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CDCA3 (aa 152-252) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP88748
This item is not returnable.
View return policy
Description
F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase. [UniProt]
Specifications
| Q99618 | |
| Blocking Assay, Control | |
| 83461 | |
| 100 μL | |
| RUO | |
| CDCA3 | |
| Human | |
| KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| CDCA3 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 2410005A12Rik; C8; CDCA 3; CDCA3; cell division cycle associated 3; cell division cycle-associated protein 3; gene rich cluster, C8; gene-rich cluster protein C8; GRCC 8; GRCC8; MGC2577; TOME 1; Tome1; TOME-1; trigger of mitotic entry 1; trigger of mitotic entry protein 1 | |
| Unconjugated | |
| Recombinant | |
| E. coli |