missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30197208

Invitrogen™ Human MTGR1 (aa 1-51) Control Fragment Recombinant Protein

Produktkod. 30197208
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30197208

Brand: Invitrogen™ RP101124

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84458 (PA5-84458. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Myeloid tumor related gene (MTGR1) is found deleted in acute myeloid leukemia. Overexpression of MTGR1 can stimulate AML1-MTG8 to induce GCSF- dependent proliferation of L-G cells and to interfere with AML1- dependent transcription. AML1/MTG8 functions as a complex with MTGR1 and that the complex might be important in promoting leukemogenesis.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer O43439
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 9139
Namn Human MTGR1 (aa 1-51) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias A430091M07; C330013D05Rik; CBFA2/RUN x 1 partner transcriptional co-repressor 2; CBFA2/RUN x 1 translocation partner 2; CBFA2T2; CBFA2T2 identified gene homolog; Cbfa2t2h; core-binding factor runt domain alpha subunit 2 translocated to 2 homolog; core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human); core-binding factor, runt domain, alpha subunit 2, translocated to, 2 homolog; core-binding factor, runt domain, alpha subunit 2; translocated to, 2; DKFZp313F2116; EHT; ETO homolog on chromosome 20; ETO homologous on chromosome 20; MTG8-like protein; MTG8-related protein 1; MTGR1; myeloid translocation gene-related protein 1; myeloid translocation-related protein 1; p85; Protein CBFA2T2; RP5-1137F22.1; translocated to, 2; ZMYND3; ZMYND3 CBFA2T2
Vanligt namn MTGR1
Gensymbol CBFA2T2
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.