missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30200510

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein

Produktkod. 30200510
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30200510

Brand: Invitrogen™ RP91392

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9Y3I0
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 51493
Namn Human RTCB (aa 340-499) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871
Vanligt namn RTCB
Gensymbol Rtcb
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.