missing translation for 'onlineSavingsMsg'
Läs mer

Novus Biologicals™ Protein kinase-like protein SgK493 Recombinant Protein Antigen

Produktkod. 18376810 Handla allt Bio Techne Produkter
Klicka för att se tillgängliga alternativ
Kvantitet:
0,1 ml
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18376810

Brand: Novus Biologicals™ NBP180756PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKDCC. Source: E.coli Amino Acid Sequence: STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQ The Protein kinase-like protein SgK493 Recombinant Protein Antigen is derived from E. coli. The Protein kinase-like protein SgK493 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-80756. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 91461
Art Human
Reningsmetod Chromatography
Renhet >80%
Koncentration 0.5mg/mL
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gensymbol PKDCC
Etiketttyp Unlabeled
Molekylvikt (g/mol) 28kDa
Produkttyp Protein kinase-like protein SgK493
Kvantitet 0,1 ml
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80756. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQ
Visa mer Visa mindre

For Research Use Only

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.