missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BHMT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4460.00 SEK
Specifications
Antigen | BHMT2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
BHMT2 Polyclonal specifically detects BHMT2 in Human samples. It is validated for Western Blot.Specifications
BHMT2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
betaine-homocysteine methyltransferase 2, betaine--homocysteine S-methyltransferase 2, EC 2.1.1.5, FLJ20001 | |
The immunogen is a synthetic peptide directed towards the middle region of human BHMT2 (NP_001171476.1). Peptide sequence FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQK | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
23743 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title