missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM222A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17365-100UL
This item is not returnable.
View return policy
Description
FAM222A Polyclonal antibody specifically detects FAM222A in Human samples. It is validated for ImmunofluorescenceSpecifications
FAM222A | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
C12orf34, chromosome 12 open reading frame 34, FLJ14721, hypothetical protein LOC84915 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA | |
100 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
84915 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction