missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fibrinopeptide A Rabbit anti-Human, Mouse, Rat, Clone: 7K8J1, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Bio-Techne NBP3-15843-100UL
This item is not returnable.
View return policy
Description
Fibrinopeptide A Monoclonal antibody specifically detects Fibrinopeptide A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Fibrinopeptide A | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
7K8J1 | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Fib2, fibrinogen alpha chain, fibrinogen, A alpha polypeptide, MGC119422, MGC119423, MGC119425 | |
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinopeptide A (FGA) (P02671). NDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA | |
100 μg | |
Cell Cycle and Replication | |
2243 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction