missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Frequenin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4480.00 SEK
Specifications
Antigen | Frequenin |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Frequenin Polyclonal specifically detects Frequenin in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
Frequenin | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Human | |
DKFZp761L1223, FREQFLUP, frequenin (Drosophila) homolog, Frequenin homolog, frequenin homolog (Drosophila), Frequenin-like protein, Frequenin-like ubiquitous protein, NCS-1, neuronal calcium sensor 1 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human Frequenin (NP_055101). Peptide sequence MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
23413 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title