missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLT8D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17856-25UL
This item is not returnable.
View return policy
Description
GLT8D2 Polyclonal antibody specifically detects GLT8D2 in Human samples. It is validated for ImmunofluorescenceSpecifications
GLT8D2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
EC 2.4.1, EC 2.4.1.-, FLJ31494, GALA4A, glycosyltransferase 8 domain containing 2, glycosyltransferase 8 domain-containing protein 2, gycosyltransferase | |
This antibody was developed against a recombinant protein corresponding to the amino acids: TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD | |
25 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
83468 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction