missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR45 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09566-100UL
This item is not returnable.
View return policy
Description
GPR45 Polyclonal specifically detects GPR45 in Human samples. It is validated for Western Blot.Specifications
GPR45 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
G protein-coupled receptor 45, high-affinity lysophosphatidic acid receptor, probable G-protein coupled receptor 45, PSP24, PSP24(ALPHA), PSP24-1, PSP24A, PSP24-alpha | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR45 (NP_009158). Peptide sequence LNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAM | |
100 μg | |
GPCR | |
11250 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction