missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-57484PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C. Source: E.coli Amino Acid Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen is derived from E. coli. The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 23081 | |
| Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA | |
| Unlabeled | |
| 100μL | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| KDM4C | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only.
Spot an opportunity for improvement?Share a Content Correction