missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-55671PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Methionine Sulfoxide Reductase A. Source: E.coli Amino Acid Sequence: AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 4482 | |
| Methionine Sulfoxide Reductase A Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-ox | |
| Unlabeled | |
| 100μL | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| MSRA | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51825. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction