missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP2-55671PEP

Product Code. 18280405

  • 2460.00 SEK / 100µL

Please to purchase this item. Need a web account? Register with us today!

Explore more special offers
This item is not returnable. View return policy

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Methionine Sulfoxide Reductase A. Source: E.coli Amino Acid Sequence: AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

4482
Methionine Sulfoxide Reductase A Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-ox
Unlabeled
100μL
E.Coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
MSRA
Recombinant Protein Antigen
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51825. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only