missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFB8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
| Antigen | NDUFB8 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18323674
|
Bio-Techne
NBP3-17898-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18378503
|
Bio-Techne
NBP3-17898-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDUFB8 Polyclonal antibody specifically detects NDUFB8 in Human samples. It is validated for Western BlotSpecifications
| NDUFB8 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS, pH 7.2, 40% glycerol | |
| 4714 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title