missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR51S1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
1925.00 SEK - 4460.00 SEK
Specifications
| Antigen | OR51S1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18321484
|
Bio-Techne
NBP3-09864-25UL |
25 μg |
1925.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18318786
|
Bio-Techne
NBP3-09864-100UL |
100 μg |
4460.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OR51S1 Polyclonal specifically detects OR51S1 in Human samples. It is validated for Western Blot.Specifications
| OR51S1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 51S1, Olfactory receptor OR11-24, olfactory receptor, family 51, subfamily S, member 1, OR11-24 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51S1 (NP_001004758). Peptide sequence LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 119692 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title