missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR5H6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10252-100UL
This item is not returnable.
View return policy
Description
OR5H6 Polyclonal specifically detects OR5H6 in Mouse samples. It is validated for Western Blot.Specifications
OR5H6 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 5H6, Olfactory receptor OR3-11, olfactory receptor, family 5, subfamily H, member 6, OR3-11 | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR5H6. Peptide sequence VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV | |
100 μg | |
Signal Transduction | |
79295 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction