missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR8U8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09834-100UL
This item is not returnable.
View return policy
Description
OR8U8 Polyclonal specifically detects OR8U8 in Human samples. It is validated for Western Blot.Specifications
OR8U8 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 8U8, olfactory receptor, family 8, subfamily U, member 8 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8U8 (NP_001013374). Peptide sequence SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
504189 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction