missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PER3 Rabbit anti-Human, Mouse, Rat, Clone: 9I3I6, Novus Biologicals™
Rabbit Monoclonal Antibody
1905.00 SEK - 4805.00 SEK
Specifications
Antigen | PER3 |
---|---|
Clone | 9I3I6 |
Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
Applications | Western Blot, Immunofluorescence |
Classification | Monoclonal |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18322745
|
Bio-Techne
NBP3-16094-20UL |
20 μg |
1905.00 SEK
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18317282
|
Bio-Techne
NBP3-16094-100UL |
100 μg |
4805.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PER3 Monoclonal antibody specifically detects PER3 in Human, Mouse, Rat samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
PER3 | |
Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila) | |
Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human PER3 (P56645). GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
9I3I6 | |
Western Blot, Immunofluorescence | |
Unconjugated | |
Rabbit | |
Cardiovascular Biology, Endocrinology | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
8863 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title