missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIRT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3440.00 SEK - 4910.00 SEK
Specifications
Antigen | PIRT |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18456221
|
Novus Biologicals
NBP1-90968-25ul |
25 μL |
3440.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18323470
|
Bio-Techne
NBP1-90968 |
0.1 mL |
4910.00 SEK
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PIRT Polyclonal specifically detects PIRT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PIRT | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
644139 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYR | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Human | |
phosphoinositide-interacting protein, phosphoinositide-interacting regulator of transient receptor potential channels, phosphoinositide-interacting regulator of TRPV1 | |
PIRT | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title