missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSKH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
Antigen | PSKH1 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18391412
|
Bio-Techne
NBP3-17299-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18322802
|
Bio-Techne
NBP3-17299-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSKH1 Polyclonal antibody specifically detects PSKH1 in Human samples. It is validated for ImmunofluorescenceSpecifications
PSKH1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Protein Kinase | |
PBS, pH 7.2, 40% glycerol | |
5681 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 2.7.11, EC 2.7.11.1, protein serine kinase H1PSK-H1, serine/threonine-protein kinase H1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAG | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title