missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SF3A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10539-100UL
This item is not returnable.
View return policy
Description
SF3A1 Polyclonal specifically detects SF3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SF3A1 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin | |
pre-mRNA processing 21, pre-mRNA splicing factor SF3a (120 kDa subunit), Prp21, PRPF21, SAP 114, SAP114splicing factor 3a, subunit 1, 120kD, SF3a120, spliceosome associated protein 114, Spliceosome-associated protein 114, splicing factor 3 subunit 1, splicing factor 3A subunit 1, splicing factor 3a, subunit 1, 120kDa | |
The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1 (NP_005868). Peptide sequence QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
10291 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction