missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sorting Nexin 31 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4460.00 SEK
Specifications
Antigen | Sorting Nexin 31 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Sorting Nexin 31 Polyclonal specifically detects Sorting Nexin 31 in Mouse samples. It is validated for Western Blot.Specifications
Sorting Nexin 31 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Signal Transduction | |
PBS buffer, 2% sucrose | |
169166 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Mouse | |
MGC39715, sorting nexin 31, sorting nexin-31 | |
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Sorting Nexin 31 (NP_079988.3). Peptide sequence QIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQ | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title