missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCEAL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
Antigen | TCEAL1 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18306766
|
Bio-Techne
NBP3-17943-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18321345
|
Bio-Techne
NBP3-17943-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCEAL1 Polyclonal antibody specifically detects TCEAL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
TCEAL1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
DNA replication Transcription Translation and Splicing | |
PBS, pH 7.2, 40% glycerol | |
9338 | |
IgG | |
Affinity purified |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Nuclear phosphoprotein p21/SIIR, p21, pp21, SIIRTCEA-like protein 1, transcription elongation factor A (SII)-like 1, transcription elongation factor A protein-like 1, Transcription elongation factor S-II protein-like 1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title