missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBXN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17958-100UL
This item is not returnable.
View return policy
Description
UBXN1 Polyclonal antibody specifically detects UBXN1 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
UBXN1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
2B28, LOC51035, SAKS1UBA/UBX 33.3 kDa protein, SAPK substrate protein 1, UBX domain protein 1, UBX domain-containing protein 1, UBXD10 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
51035 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction