missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP35 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4480.00 SEK
Specifications
| Antigen | USP35 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
USP35 Polyclonal specifically detects USP35 in Human samples. It is validated for Western Blot.Specifications
| USP35 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Deubiquitinating enzyme 35, EC 3.4.19.12, KIAA1372, ubiquitin carboxyl-terminal hydrolase 35, ubiquitin specific peptidase 35, ubiquitin specific protease 35, ubiquitin thioesterase 35, Ubiquitin thiolesterase 35, Ubiquitin-specific-processing protease 35, USP34 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human USP35 (NP_065849). Peptide sequence MEAISKDNILYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSP | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 57558 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title