missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF552 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
1925.00 SEK - 4460.00 SEK
Specifications
| Antigen | ZNF552 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18323214
|
Bio-Techne
NBP3-09925-25UL |
25 μg |
1925.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18399955
|
Bio-Techne
NBP3-09925-100UL |
100 μg |
4460.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF552 Polyclonal specifically detects ZNF552 in Human samples. It is validated for Western Blot.Specifications
| ZNF552 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ZNF552 zinc finger protein 552 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human ZNF552 (NP_079038). Peptide sequence RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQH | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 79818 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title