missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF83 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4460.00 SEK
Specifications
Antigen | ZNF83 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ZNF83 Polyclonal specifically detects ZNF83 in Human samples. It is validated for Western Blot.Specifications
ZNF83 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
FLJ11015, FLJ30097, FLJ90585, HPF1, MGC33853, Zinc finger protein 816BFLJ14876, zinc finger protein 83, zinc finger protein 83 (HPF1), Zinc finger protein HPF1, ZNF816B | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF83 (NP_060770). Peptide sequence MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
55769 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title