missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP2-76547
This item is not returnable.
View return policy
Description
ATR Polyclonal specifically detects ATR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ATR | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
ataxia telangiectasia and Rad3 related, Ataxia telangiectasia and Rad3-related protein, EC 2.7.11.1, FRAP-related protein 1, FRP1FRAP-related protein-1, MEC1, protein kinase ATR, Rad3 related protein, SCKL1, SCKLMEC1, mitosis entry checkpoint 1, homolog, serine/threonine-protein kinase ATR | |
Rabbit | |
Affinity Purified | |
Breast Cancer, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Immunology, p53 Pathway, Virology Bacteria and Parasites | |
545.0 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
ATR | |
This antibody was developed against Recombinant Protein corresponding to amino acids: FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction