missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3440.00 SEK - 4990.00 SEK
Specifications
Antigen | ATR |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18635311
|
Novus Biologicals
NBP2-76547-25ul |
25 μL |
3440.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18321241
|
Bio-Techne
NBP2-76547 |
100 μL |
4990.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATR Polyclonal specifically detects ATR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ATR | |
Polyclonal | |
Rabbit | |
Human | |
ataxia telangiectasia and Rad3 related, Ataxia telangiectasia and Rad3-related protein, EC 2.7.11.1, FRAP-related protein 1, FRP1FRAP-related protein-1, MEC1, protein kinase ATR, Rad3 related protein, SCKL1, SCKLMEC1, mitosis entry checkpoint 1, homolog, serine/threonine-protein kinase ATR | |
ATR | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
Breast Cancer, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Immunology, p53 Pathway, Virology Bacteria and Parasites | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
545.0 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title