missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Bcl-2 related protein A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10872-100UL
This item is not returnable.
View return policy
Description
Bcl-2 related protein A1 Polyclonal specifically detects Bcl-2 related protein A1 in Human samples. It is validated for Western Blot.Specifications
| Bcl-2 related protein A1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| ACC-1, ACC-2, Bcl2-L-5, BCL2L5HBPA1, Bcl-2-like protein 5, BCL2-related protein A1, BFL1bcl-2-related protein A1, GRSbcl2-L-5, hematopoietic BCL2-related protein A1, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human Bcl-2 related protein A1 (NP_004040). Peptide sequence FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY | |
| 100 μg | |
| Apoptosis, Cancer | |
| 597 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction