missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BJHCC20A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17470-25UL
This item is not returnable.
View return policy
Description
BJHCC20A Polyclonal antibody specifically detects BJHCC20A in Human samples. It is validated for ImmunofluorescenceSpecifications
BJHCC20A | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
BJHCC20A, Cancer/testis antigen 55, chromosome X open reading frame 48, CT55, CT55 BRCA2-interacting protein, CXorf48, FLJ20527, RP13-565O16.1, Tumor antigen BJ-HCC-20 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG | |
25 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
54967 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction