missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BJHCC20A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
| Antigen | BJHCC20A |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18321507
|
Bio-Techne
NBP3-17470-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18337244
|
Bio-Techne
NBP3-17470-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BJHCC20A Polyclonal antibody specifically detects BJHCC20A in Human samples. It is validated for ImmunofluorescenceSpecifications
| BJHCC20A | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| BJHCC20A, Cancer/testis antigen 55, chromosome X open reading frame 48, CT55, CT55 BRCA2-interacting protein, CXorf48, FLJ20527, RP13-565O16.1, Tumor antigen BJ-HCC-20 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 54967 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title