missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCFC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09963-100UL
This item is not returnable.
View return policy
Description
GCFC2 Polyclonal specifically detects GCFC2 in Human samples. It is validated for Western Blot.Specifications
GCFC2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C2orf3, chromosome 2 open reading frame 3, DNABF, GC bindng factor, GCF, GCFGC binding factor, GC-rich sequence DNA-binding factor, GC-rich sequence DNA-binding factor 2, TCF9, TCF-9, Transcription factor 9, transcription factor 9 (binds GC-rich sequences) | |
The immunogen is a synthetic peptide directed towards the middle region of human TCF9 (NP_003194). Peptide sequence QKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKLLNP | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
6936 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction