missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glypican 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17858-25UL
This item is not returnable.
View return policy
Description
Glypican 4 Polyclonal antibody specifically detects Glypican 4 in Human samples. It is validated for ImmunofluorescenceSpecifications
Glypican 4 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
glypican 4, glypican proteoglycan 4, glypican-4, K-glypicandJ900E8.1 (glypican 4) | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMAL | |
25 μg | |
Cancer, Stem Cells | |
2239 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction