missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glypican 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
| Antigen | Glypican 4 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18308203
|
Bio-Techne
NBP3-17858-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18337254
|
Bio-Techne
NBP3-17858-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glypican 4 Polyclonal antibody specifically detects Glypican 4 in Human samples. It is validated for ImmunofluorescenceSpecifications
| Glypican 4 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Stem Cells | |
| PBS, pH 7.2, 40% glycerol | |
| 2239 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| glypican 4, glypican proteoglycan 4, glypican-4, K-glypicandJ900E8.1 (glypican 4) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMAL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title