missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR10P1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09857-100UL
This item is not returnable.
View return policy
Description
OR10P1 Polyclonal specifically detects OR10P1 in Human samples. It is validated for Western Blot.Specifications
OR10P1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 10P1, Olfactory receptor 10P2, Olfactory receptor 10P3, Olfactory receptor OR12-7, olfactory receptor, family 10, subfamily P, member 1, olfactory receptor, family 10, subfamily P, member 1 pseudogene, olfactory receptor, family 10, subfamily P, member 2 pseudogene, olfactory receptor, family 10, subfamily P, member 3 pseudogene, OR10P1P, OR10P2P, OR10P3P, OR12-7, OST701, seven transmembrane helix receptor | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10P1 (NP_996782). Peptide sequence LFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
121130 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction