missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR10P1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4460.00 SEK
Specifications
| Antigen | OR10P1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR10P1 Polyclonal specifically detects OR10P1 in Human samples. It is validated for Western Blot.Specifications
| OR10P1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 10P1, Olfactory receptor 10P2, Olfactory receptor 10P3, Olfactory receptor OR12-7, olfactory receptor, family 10, subfamily P, member 1, olfactory receptor, family 10, subfamily P, member 1 pseudogene, olfactory receptor, family 10, subfamily P, member 2 pseudogene, olfactory receptor, family 10, subfamily P, member 3 pseudogene, OR10P1P, OR10P2P, OR10P3P, OR12-7, OST701, seven transmembrane helix receptor | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10P1 (NP_996782). Peptide sequence LFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 121130 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title