missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAR4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17410-100UL
This item is not returnable.
View return policy
Description
PAR4 Polyclonal antibody specifically detects PAR4 in Human samples. It is validated for ImmunofluorescenceSpecifications
PAR4 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
proteinase-activated receptor 4, coagulation factor II (thrombin) receptor-like 3, PAR4 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ | |
100 μg | |
GPCR | |
9002 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction