missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAR4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
| Antigen | PAR4 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18311904
|
Bio-Techne
NBP3-17410-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18322415
|
Bio-Techne
NBP3-17410-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PAR4 Polyclonal antibody specifically detects PAR4 in Human samples. It is validated for ImmunofluorescenceSpecifications
| PAR4 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS, pH 7.2, 40% glycerol | |
| 9002 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| proteinase-activated receptor 4, coagulation factor II (thrombin) receptor-like 3, PAR4 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title