missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Segmentation protein paired Rabbit anti-Drosophila, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09255-100UL
This item is not returnable.
View return policy
Description
Segmentation protein paired Polyclonal specifically detects Segmentation protein paired in Drosophila samples. It is validated for Western Blot.Specifications
Segmentation protein paired | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
PRD | |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly (NP_723721). Peptide sequence MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL | |
100 μg | |
Primary | |
Drosophila | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
34629 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction