missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Segmentation protein paired Rabbit anti-Drosophila, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4480.00 SEK
Specifications
Antigen | Segmentation protein paired |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Segmentation protein paired Polyclonal specifically detects Segmentation protein paired in Drosophila samples. It is validated for Western Blot.Specifications
Segmentation protein paired | |
Western Blot | |
Unconjugated | |
Rabbit | |
Drosophila | |
PRD | |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly (NP_723721). Peptide sequence MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
34629 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title