Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

1 – 15 of 78,029 results

Invitrogen™ Human VCAM-1 Recombinant Protein

Recombinant Protein

Pricing and Availability

Invitrogen™ Human ErbB2 (HER-2) Fc Chimera Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Purity or Quality Grade	≥90% as determined by SDS-PAGE. ≥90% as determined by SEC-HPLC.
Conjugate	Unconjugated
Form	Lyophilized
Common Name	Her-2 (ErbB2)
Molecular Weight (g/mol)	130-140 kDa
Gene Symbol	ERBB2
Activity	1. Immobilized Her2/ERBB2 Protein, Human, Recombinant (ECD, hFc Tag) (at 2 μg/ml (100 μL/well) can bind Anti-Erbb2 Antibody (Trastuzumab), the EC50 is 16-80 ng/mL 2. Measured by its ability to block anti-ErbB2 mediated inhibition of BT474 human breast ductal carcinoma cell proliferation. The ED50 for this effect is 0.5-3 μg/mL in the presence of 0.6 μg/mL Anti-ErbB2/Her2 Monoclonal Antibody.)
Endotoxin Concentration	<1.0 EU/ μg
Sequence	Human ErbB2, amino acids Met1-Thr652 (Accession # NP_004439.2) with a C-terminal human IgG1 Fc region
Concentration	0.83 mg/mL
Expression System	HEK293 cells
For Use With (Application)	ELISA,Functional Assay
Name	Human ErbB2 (HER-2) Fc Chimera
Accession Number	P04626
Regulatory Status	RUO
Purification Method	SDS-PAGE
Gene Alias	avian erythroblastosis oncogene B 2; Avian erythroblastosis viral (v-erb-B2) oncogene homologue 2 (neuro/glioblastoma derived oncogene homolog); CD antigen CD340; CD340; c-erb B2/neu protein; c-erbB2; C-erbB-2; c-neu; epidermal growth factor receptor-related protein; erbb 2; ERBB2; erb-b2; Erbb-2; ErbB2 (pTyr1139); ErbB2 (pY1139); ErbB2 phospho Y1139; erb-b2 receptor tyrosine kinase 2; her 2; HER2; HER-2; HER-2/neu; herstatin; human epidermal growth factor receptor 2; Kiaa3023; metas; Metastatic lymph node gene 19 protein; mKIAA3023; MLN 19; MLN19; NEU; Neu oncogene; NEU proto-oncogene; neuro/glioblastoma derived oncogene homolog; neuroblastoma/glioblastoma derived oncogene homolog; NGL; p185erbB2; p185neu; phospho ErbB2; proto-oncogene c-ErbB-2; Proto-oncogene Neu; receptor tyrosine-protein kinase erbB-2; TKR1; Tyrosine kinase-type cell surface receptor HER2; v-erb-b2 avian erythroblastic leukemia viral oncogene 2; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2; v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Format	Lyophilized
Product Type	Protein
Biological Activity	1. Immobilized Her2/ERBB2 Protein, Human, Recombinant (ECD, hFc Tag) (at 2 μg/ml (100 μL/well) can bind Anti-Erbb2 Antibody (Trastuzumab), the EC50 is 16-80 ng/mL 2. Measured by its ability to block anti-ErbB2 mediated inhibition of BT474 human breast ductal carcinoma cell proliferation. The ED50 for this effect is 0.5-3 μg/mL in the presence of 0.6 μg/mL Anti-ErbB2/Her2 Monoclonal Antibody.)
Gene ID (Entrez)	2064
Formulation	PBS with 0.01% Tween 80, 5% mannitol, 5% trehalose and no preservative; pH 7.4
Protein Tag	Fc-tag
Recombinant	Recombinant

Invitrogen™ Human PRG2 (aa 61-128) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability

Invitrogen™ Human KIRREL3 (aa 670-768) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability

Invitrogen™ Human DMAP1 (aa 242-338) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability

Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability

Invitrogen™ Human Tau (aa 298-380) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability

Abnova™ GST Protein

GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.

Pricing and Availability
Specifications

Accession Number	AAB37352
Target Species Named	Human
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue
Sequence	MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Storage Requirements	Store at -80°C Aliquot to avoid repeated freezing and thawing
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Source	Wheat Germ (in vitro)

Form	Solution
pH Range	8
Common Name	PSIP1
Molecular Weight (g/mol)	31.13
Gene Symbol	PSIP1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Source	Wheat Germ (in vitro)
Name	PSIP1 (Human) Recombinant Protein (P01)
Accession Number	AAH33817
Purification Method	Glutathione Sepharose 4 Fast Flow
Preparation Method	In vitro wheat germ expression system
Gene Alias	DFS70/LEDGF/MGC74712/PAIP/PSIP2/p52/p75
Gene ID (Entrez)	11168
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Immunogen	MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Cross Reactivity	Human
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

enQuireBio™ Recombinant Human EPOR Protein

A cDNA sequence encoding the EPOR was constructed and used to recombinantly synthesize the protein.

Pricing and Availability
Specifications

Buffer	EPOR protein solution (0.5 mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Regulatory Status	Research Use Only
Purity or Quality Grade	Greater than 95.0% as determined by analysis by SDS-PAGE.
Product Type	Recombinant Protein
Biological Activity	Measured by its ability to inhibit EPO dependent proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect less or equal to 70ng/ml.
Gene ID (Entrez)	2057
Gene Symbol	EPOR
Endotoxin Concentration	< 1.0 EU per ug protein as determined by the LAL method.
Sequence	APPPNLPDPK FESKAALLAA RGPEELLCFT ERLEDLVCFW EEAASAGVGP GNYSFSYQLE DEPWKLCRLH QAPTARGAVR FWCSLPTADT SSFVPLELRV TAASGAPRYH RVIHINEVVL LDAPVGLVAR LADESGHVVL RWLPPPETPM TSHIRYEVDV SAGNGAGSVQ RVEILEGRTE CVLSNLRGRT RYTFAVRARM AEPSFGGFWS AWSEPVSLLT PSDLDPHHHH HH
Cross Reactivity	Human
Protein Tag	His
Species	Baculovirus
Name	EPOR Protein

Novus Biologicals™ Recombinant Protein A/G Protein

Recombinant Protein

Pricing and Availability

R&D Systems™ Recombinant Mouse Wnt-9a Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	37 kDa
Gene ID (Entrez)	216795
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Chinese Hamster Ovary cell line,CHO-derived mouse Wnt-9a protein Tyr30-Gly365
Recombinant	Recombinant
Name	Wnt-9a

Novus Biologicals™ Recombinant Human CSK His Protein

Highly purified. Generating reliable and reproducible results.

Pricing and Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	C-Src kinase, c-src tyrosine kinase, EC 2.7.10, EC 2.7.10.2, MGC117393, Protein-tyrosine kinase CYL, tyrosine-protein kinase CSK
Common Name	CSK
Molecular Weight (g/mol)	TMW: 53.1kDa
Gene ID (Entrez)	1445
Formulation	Phosphate buffered saline (pH 7.4) containing 20% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

R&D Systems™ Recombinant Human PPA1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability

R&D Systems™ Recombinant Human NF-L Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability

Prev
1
2
3
4
5
6
...
5,202
Next

Recombinant Proteins

Recombinant Proteins

Invitrogen™ Human VCAM-1 Recombinant Protein

Invitrogen™ Human ErbB2 (HER-2) Fc Chimera Recombinant Protein

Invitrogen™ Human PRG2 (aa 61-128) Control Fragment Recombinant Protein

Invitrogen™ Human KIRREL3 (aa 670-768) Control Fragment Recombinant Protein

Invitrogen™ Human DMAP1 (aa 242-338) Control Fragment Recombinant Protein

Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein

Invitrogen™ Human Tau (aa 298-380) Control Fragment Recombinant Protein

Abnova™ GST Protein

Abnova™ PSIP1 Recombinant Protein

enQuireBio™ Recombinant Human EPOR Protein

Novus Biologicals™ Recombinant Protein A/G Protein

R&D Systems™ Recombinant Mouse Wnt-9a Protein

Novus Biologicals™ Recombinant Human CSK His Protein

R&D Systems™ Recombinant Human PPA1 Protein

R&D Systems™ Recombinant Human NF-L Protein

You recently viewed...Show

Filtered Search Results

Recombinant Proteins

Recombinant Proteins

Selected Filters

Narrow Results

Narrow Results

Filtered Search Results